Indonesian Journal of Cultural and Community Development
Vol 15 No 3 (2024): September
Community Education Development Articles

Social Support as a Catalyst for Environmental Awareness in Indonesia
Dukungan Sosial sebagai Katalisator Kesadaran Lingkungan di Indonesia


  • Ahmad Naufal,
  • Nurfi Laili*
Ahmad Naufal
Universitas Muhammadiyah Sidoarjo, Indonesia
Nurfi Laili
Universitas Muhammadiyah Sidoarjo, Indonesia *

(*) Corresponding Author
Picture in here are illustration from public domain image or provided by the author, as part of their works
DOI: https://doi.org/10.21070/ijccd.v15i3.1101
Published October 2, 2024
Keywords
  • environmental awareness,
  • social support,
  • Tutur village,
  • quantitative research,
  • sustainability
How to Cite
Naufal, A., & Laili, N. (2024). Social Support as a Catalyst for Environmental Awareness in Indonesia. Indonesian Journal of Cultural and Community Development, 15(3), 10.21070/ijccd.v15i3.1101. https://doi.org/10.21070/ijccd.v15i3.1101

Copyright (c) 2024 Ahmad Naufal, Nurfi Laili

Creative Commons License

This work is licensed under a Creative Commons Attribution 4.0 International License.

Abstract

General Background: Environmental awareness is crucial for communities to preserve ecosystems and prevent environmental degradation. Social support can play a significant role in fostering this awareness. Specific Background: In rural communities like Tutur village, Pasuruan regency, environmental awareness and social support are often interconnected. However, the extent to which social support influences environmental awareness remains underexplored. Knowledge Gap: While studies have examined environmental education and awareness, few have investigated the role of social support as a driving factor in increasing environmental responsibility in village settings. Aims: This study aims to examine the influence of social support on environmental awareness among the residents of Tutur village, focusing on the relationship between these variables using quantitative methods. Results: The findings from simple linear regression analysis reveal that social support has a significant effect on environmental awareness, indicating that residents with stronger social ties exhibit higher levels of concern and action toward environmental preservation. Novelty: This study offers a novel insight by quantitatively demonstrating the direct relationship between social support and environmental awareness in rural communities, highlighting social dynamics as a key factor in environmental education. Implications: The results suggest that enhancing social support networks through community-driven initiatives can significantly improve environmental consciousness and foster sustainable tourism development, particularly in rural areas like Tutur village. This study provides a basis for future research on integrating social support frameworks into environmental sustainability strategies, particularly in regions with strong communal ties.

Highlights:

 

  1. Social support boosts environmental awareness in community residents.
  2. Strong community ties enhance responsibility for environmental preservation.
  3. Findings promote initiatives to improve environmental consciousness and tourism.

 

Keywords: environmental awareness, social support, Tutur village, quantitative research, sustainability

References

  1. J. Pengabdian and K. Masyarakat, “Anis Nurhayati, dkk | 127,” vol. 2, 2020.
  2. R. A. Lestari, “Reformasi Birokrasi Sebagai Pelayan Publik,” Din. Gov. J. Ilmu Adm. Negara, vol. 9, no. 1, 2019, doi: 10.33005/jdg.v9i1.1421.
  3. N. Purwanto, “Perilaku Sadar Lingkungan Pemukim Bantaran Sungai Jelai, Kabupaten Sukamara,” J. Pembang. Wil. Kota, vol. 14, no. 1, p. 41, 2018, doi: 10.14710/pwk.v14i1.17348.
  4. L. M. A. Sa’ban, A. Sadat, and A. Nazar, “Jurnal PKM Meningkatkan Pengetahuan Masyarakat Dalam Perbaikan Sanitasi Lingkungan,” Din. J. Pengabdi. Kpd. Masy., vol. 5, no. 1, pp. 10–16, 2020, doi: 10.31849/dinamisia.v5i1.4365.
  5. E. Maulana and H. C. Haryanto, “Bagaimana Kondisi Kesadaran Lingkungan Terkait Pencemaran Udara Yang Dimiliki Oleh Masyarakat Perkotaan? (Studi Pendahuluan Pada Masyarakat Di Jakarta).,” Inq. J. Ilm. Psikol., vol. 11, no. 1, pp. 40–50, 2020, doi: 10.51353/inquiry.v11i1.415.
  6. E. Kokkinen, “Measuring environmental awareness in the world,” pp. 9–54, 2013.
  7. T. Theodoridis and J. Kraemer, Partanen-Hertell,M.,Harju-Aui,P.,Kreft-Burman,K.,&Pemberton,D.(1999).RaisingenvironmentalawarenessintheBalticSeaarea. 1999.
  8. P. W. P. Suta and I. G. A. O. Mahagangga, “Pengembangan Pariwisata Berbasis Masyarakat,” J. Destin. Pariwisata, vol. 5, no. 1, p. 144, 2018, doi: 10.24843/jdepar.2017.v05.i01.p26.
  9. B. M. K. Hagerty and K. Patusky, “Developing a measure of sense of belonging,” Nurs. Res., vol. 44, no. 1, pp. 9–13, 1995, doi: 10.1097/00006199-199501000-00003.
  10. M. Muhaeminah, “Game therapy untuk meningkatkan sense of belonging anak panti asuhan,” J. Ilm. Psikol. Terap., vol. 3, no. 1, pp. 32–53, 2016.
  11. F. Amalia, A, “Amalia,A.F.(2020).Hubungansenseofbelongingdenganpartisipasimasyarakatpadabanksampahdiwilayahkecamatankemayoran.UNIVERSITASNEGERIJAKARTA,” 2020.
  12. C. S. M. Hutajulu, S. Sherly, and H. Herman, “Peran Aplikasi Tiktok Terhadap Minat Belajar Siswa SMA,” Edukatif J. Ilmu Pendidik., vol. 4, no. 2, pp. 3002–3010, 2022, doi: 10.31004/edukatif.v4i2.2546.
  13. N. Munthe, “Pengaruh Persepsi dan Motivasi Mahasiswa Terhadap Minat Bekerja di Sektor Perbankan Syariah,” vol. 1, no. 4, p. 46, 2021.
  14. S. D. Cahyanti, “HUBUNGAN ANTARA SENSE OF BELONGING DENGAN KETERLIBATAN PEGAWAI NEGRI SIPIL RUTAN KELAS II B PEKANBARU Sisly,” Corp. Gov., vol. 10, no. 1, pp. 54–75, 2020.
  15. L. N. Lestari and D. K. Dewi, “Perbedaan Sense Of Belongingness Ditinjau Dari Tahun Angkatan Pada Mahasiswa Universitas Negeri Surabaya,” Character J. Penelit. Psikol., vol. 07, no. 2, pp. 52–61, 2020, [Online]. Available: https://ejournal.unesa.ac.id/index.php/character/article/view/33696
  16. F. SUTRA BUKHARI and R. ROSYIDAH, “Pengaruh Sense of Belonging Terhadap Kesadaran Lingkungan Masyarakat Sekitar Wisata Pantai Tlangoh Kecamatan Tanjung Bumi Kabupaten Bangkalan,” J. Psikol. Poseidon, vol. 6, no. 1995, pp. 1–14, 2023, doi: 10.30649/jpp.v6i1.77.
  17. R. Irawan, S. Mersa, and J. Mulyono, “Partisipasi Masyarakat Dalam Pembangunan Fisik Di Desa Negara Nabung Kecamatan Sukadana Kabupaten Lampung Timur Dalam Pembangunan,” Adm. J. Ilm. Adm. Publik dan Pembang., vol. 9, no. 1, pp. 43–50, 2018, doi: 10.23960/administratio.v9i1.63.
  18. E. Maria, A. Sudarso, and J. T. K. Perangin-Angin, “Membangun Sense of Belonging (Rasa Memiliki) Individu Dan Menerapkannya Sebagai Wujud Motivasi Diri Dalam Bekerja Dan Kecintaan Terhadap Organisasi Pada Ypk Don Bosco Kam,” J. Pengabdi. Pada Masy. METHABDI, vol. 3, no. 1, pp. 104–112, 2023, doi: 10.46880/methabdi.vol3no1.pp104-112.
  19. Putri N R & Suryanto, “Hubungan antara Perilaku Altruisme dengan Partisipasi Sosial pada Anggota Karang Taruna dengan Rasa Kepemilikan Organisasi (Sense of Belonging) sebagai Variable Intervening,” J. Psikol. Kepribadian dan Sos., vol. 7, pp. 1–12, 2018.
  20. Suryati, “pengembangan sense of belonging yang dilakukan di PT X dilihat dari perspektif behavioristik,” Pelayanan Kesehat., no. 2015, pp. 3–13, 2019.
  21. L. Latifah, R. A. Pohan, and M. Nasir, “Gambaran Sense of Belonging Mahasiswa Program Studi Bimbingan dan Konseling Islam Fakultas Ushuluddin Adab dan Dakwah IAIN Langsa,” Cons. Berk. Kaji. Konseling dan Ilmu Keagamaan, vol. 8, no. 1, p. 35, 2021, doi: 10.37064/consilium.v8i1.8156.
  22. I. Faqihantara and W. M. Manoby, “Empowering the Youths through the Skilled Youth Program III as Citi Indonesia’s Corporate Social Responsibility Activity,” MITRA J. Pemberdaya. Masy., vol. 4, no. 2, pp. 161–171, 2020, doi: 10.25170/mitra.v4i2.1295.
  23. F. Felicia, Rostiana, and A. Malik Gismar, “Peran Sense of Belonging terhadap Stres Digital dengan Locus of Control sebagai Moderator,” J. Muara Ilmu Sos. Humaniora, dan Seni, vol. 6, no. 3, pp. 650–659, 2023, doi: 10.24912/jmishumsen.v6i3.19149.2022.
  24. Z. A. A. A. Attamimi, “Hubungan Antara Sense Of Belonging Dengan Organizational Citizenship Behavior (OCB) Pada Karyawan Yayasan Bakii Cilacap,” p. 70, 2019.
  25. H. Kurniawan, I. A. Brahmasari, I. Aju, and B. Ratih, “Proceeding International Conference on Economic Business Management, and Accounting (ICOEMA)-2022 Program Studi Doktor Ilmu Ekonomi Universitas 17 Agustus 1945 Surabaya-2022 The effect of empowering leadership, locus of control and sense of belonging on t,” pp. 822–849, 2022.
  26. A. Galli et al., “Assessing the Ecological Footprint and biocapacity of Portuguese cities: Critical results for environmental awareness and local management,” Cities, vol. 96, Jan. 2020, doi: 10.1016/j.cities.2019.102442.